Scaffold Ga0105164_10578894

Overview

Basic Information

• Taxon OID: 3300009777
• Scaffold ID: Ga0105164_10578894
• Source Dataset Name: Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 557
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Netherlands
• Coordinates
  • Lat. (^o): 52.2278
  • Long. (^o): 5.919

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005383	Metagenome / Metatranscriptome	402	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105164_105788941	F005383	N/A	TEDGGRRFDFSITATGEEATPASLVIPPMMFTGTDRISFQESAKICYEKLRVLLANQKVQTPLRIRLTGDDIAQFRHVPRGRQRFPKA*