NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0116164_10364143

Scaffold Ga0116164_10364143


Overview

Basic Information
Taxon OID3300009775 Open in IMG/M
Scaffold IDGa0116164_10364143 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC109_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)602
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division TA06 → candidate division TA06 bacterium 34_109(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameHong Kong
CoordinatesLat. (o)22.28Long. (o)114.17Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021489Metagenome / Metatranscriptome218N

Sequences

Protein IDFamilyRBSSequence
Ga0116164_103641431F021489AGGAGMSIEKKIGSVQEYNLLKLLKANSDLKRFGVEWNKLDLDHALCRVFATNGYAIIVAELEPNQWHDIFDGLPELVFITKLKRDEVHYFEAKELEKFNYLSVFEAVGKEPNYQPVMHLDLKLLRNLTDKFDDVYFVKQSGLALFMKLEGDKYPAGSYYGALMPKSITQEETAKIIEALSSLAT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.