| Basic Information | |
|---|---|
| Taxon OID | 3300009754 Open in IMG/M |
| Scaffold ID | Ga0123364_1128939 Open in IMG/M |
| Source Dataset Name | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_198_18m (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 840 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Microbial And Viral Regulation Of Community Carbon Cycling Across Diverse Low-Oxygen Zones |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Louisana Shelf, Hypoxic Zone, Gulf of Mexico | |||||||
| Coordinates | Lat. (o) | 28.8679 | Long. (o) | -90.4764 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F099851 | Metagenome / Metatranscriptome | 103 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0123364_11289392 | F099851 | N/A | MKIIDCRDFPTAINHAEKEWQKKTKKSKPTNFQEATEIVCDAMKLMIISKNHKYGKNNILKFGQQGIFMRDWDKICRLEEGIIKGKDLGEEGLLETWADNAGYSIVAMLLEKKWYELPVDV* |
| ⦗Top⦘ |