Scaffold Ga0116163_1021895

Overview

Basic Information

• Taxon OID: 3300009713
• Scaffold ID: Ga0116163_1021895
• Source Dataset Name: Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC107_MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2909
• Total Scaffold Genes: 11
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (18.18%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp. 224 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: Hong Kong
• Coordinates
  • Lat. (^o): 22.28
  • Long. (^o): 114.17

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082381	Metagenome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116163_10218955	F082381	N/A	MQNKSLKKQKSKGGKRVGSGRKKANYQTKTIAFRVRVEWIDVIKSTVKAKVAELSQNSR*