| Basic Information | |
|---|---|
| Taxon OID | 3300009709 Open in IMG/M |
| Scaffold ID | Ga0116227_10249355 Open in IMG/M |
| Source Dataset Name | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1367 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated → Host-Associated Microbial Communities From Peat Moss Sphagnum Species From Minnesota, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Minnesota | |||||||
| Coordinates | Lat. (o) | 47.5028 | Long. (o) | -93.4828 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004752 | Metagenome / Metatranscriptome | 425 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0116227_102493552 | F004752 | N/A | MRPMAGFEHLFKTYDIADQLDDIASADPPAYLRRCFAEGLSTPELSLPRVQQIAVCGMVLDSVVNYRDYATLEPELIADWRAHYEPACERMRDTAVAALRRAVDRLRTLDEDAASELEELEHRLAA* |
| ⦗Top⦘ |