Scaffold Ga0114933_10965627

Overview

Basic Information

• Taxon OID: 3300009703
• Scaffold ID: Ga0114933_10965627
• Source Dataset Name: Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 540
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location

• Location Name: Kolumbo volcano, Aegean Sea
• Coordinates
  • Lat. (^o): 36.5275
  • Long. (^o): 25.4871
  • Depth (m): 495

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020260	Metagenome	225	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114933_109656271	F020260	N/A	RIPELEQLMIEMTEEAVSVKLDYEQSGSNLDSGSVIAIHHNSPLLQDEREKLSDIAYNVKRKENE*