Scaffold Ga0114933_10521611

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0114933_10521611

Scaffold Ga0114933_10521611

Overview

Basic Information
Taxon OID	3300009703 Open in IMG/M
Scaffold ID	Ga0114933_10521611 Open in IMG/M
Source Dataset Name	Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	770
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location
Location Name	Kolumbo volcano, Aegean Sea
Coordinates	Lat. (^o)	36.5275	Long. (^o)	25.4871	Alt. (m)		Depth (m)	495
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030051	Metagenome	186	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114933_105216112	F030051	GGAG	MPTDPNTLGHFFENFTTSMFSVVIALIGFWTTFVKNLVNRKEVEEMIAATAQSSQYAQDRQFIMERLNSHKEDSSILFRALEKNTEVMNELKVQIATLGKTLETLEN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.