Scaffold Ga0123337_10083080

Overview

Basic Information

• Taxon OID: 3300009695
• Scaffold ID: Ga0123337_10083080
• Source Dataset Name: Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - frozenSSSS metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2000
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Borup Fiord, Nunavut, Canada
• Coordinates
  • Lat. (^o): 81.017
  • Long. (^o): -81.583
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071767	Metagenome	122	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0123337_100830802	F071767	N/A	MVKAMDEEQLIEEISHHESLLKIQRRNLRALELQIAQHGPFDVPLHMRGAQDDLRAEVARLDRALRDLRTRRRRQKPKR*