Scaffold Ga0123338_10075718

Overview

Basic Information

• Taxon OID: 3300009686
• Scaffold ID: Ga0123338_10075718
• Source Dataset Name: Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - groundupSSSS metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1831
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Borup Fiord, Nunavut, Canada
• Coordinates
  • Lat. (^o): 81.017
  • Long. (^o): -81.583
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004608	Metagenome / Metatranscriptome	431	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0123338_100757182	F004608	N/A	MHPTFDQTRPQPSRWDQHGAEYVRSNIDWCARCSRRLVALNPGLMVEQALDLSQELSLDDNLRSKSPELVAEDLHRVDLQTED*