Scaffold Ga0116174_10390481

Overview

Basic Information

• Taxon OID: 3300009681
• Scaffold ID: Ga0116174_10390481
• Source Dataset Name: Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC087_MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 650
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: USA
• Coordinates
  • Lat. (^o): 39.88
  • Long. (^o): -75.22

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045749	Metagenome / Metatranscriptome	152	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116174_103904811	F045749	N/A	DATGDYFEYLFAESEKHAGAIKTFLLKYKISDDFKASGRAPDTKSRQAMIQATISPEQCSVEDLINKHDCAVVNGRILDVTWLAKLCENEGEILPPTRTLGHILSDMGYSQIDGRRVYIKKTNTQHYVWFKHSPKNDSQSVKKEVILFFKGDFDEIPF*