| Basic Information | |
|---|---|
| Taxon OID | 3300009677 Open in IMG/M |
| Scaffold ID | Ga0115104_10443003 Open in IMG/M |
| Source Dataset Name | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 714 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Eukaryotic Communities From Various Locations To Study Complex Ecological Interactions |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 36.1275 | Long. (o) | -123.299 | Alt. (m) | Depth (m) | 10 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F038905 | Metagenome / Metatranscriptome | 165 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0115104_104430031 | F038905 | AGGAG | MTTYSGIDGVATNVTTETKTLQVGRTRVYGVHVSGPNAAGVLDLKDGTVSKVKLNKGAHIHDMTINFPVPILFKTNLNSTFTTEQITAITVFHSGGDNS* |
| ⦗Top⦘ |