Scaffold Ga0115104_10061742

Overview

Basic Information

• Taxon OID: 3300009677
• Scaffold ID: Ga0115104_10061742
• Source Dataset Name: Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 761
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Eukaryotic Communities From Various Locations To Study Complex Ecological Interactions

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 36.1275
  • Long. (^o): -123.299
  • Depth (m): 10

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051157	Metagenome / Metatranscriptome	144	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115104_100617422	F051157	AGGAG	MILSLTHIATNIPVDIELDLVELAWAKDKNPKTLNESWEKLCESVLQRTGHDIQGNFELETLGGRPIH*