Scaffold Ga0116173_1000527

Overview

Basic Information

• Taxon OID: 3300009674
• Scaffold ID: Ga0116173_1000527
• Source Dataset Name: Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC085_MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 35621
• Total Scaffold Genes: 39
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 27 (69.23%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. SCADC (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: USA
• Coordinates
  • Lat. (^o): 39.88
  • Long. (^o): -75.22

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016758	Metagenome / Metatranscriptome	245	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116173_10005278	F016758	N/A	MKFIQEFSGGFNMNVKGIIFNTGKSTIIKVFGQAPWDAFMAKLVAKDKFFGNMIMSITPIPLEKFIFFLDELVKEFFNNDMMQYVTFGKVAAQFALSPDGIYKSYLLTKDTKQFVETVMPKFWSTYFDEGVVTTRFENNVAHLKITGLNFRHNYFEFLIMGFFQKSLKMFGKKNVPKRIRSRASGDEDVYFQFELKDA*