Basic Information | |
---|---|
Taxon OID | 3300009670 Open in IMG/M |
Scaffold ID | Ga0116183_1257000 Open in IMG/M |
Source Dataset Name | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 779 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → SAR324 cluster → SAR324 cluster bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA | |||||||
Coordinates | Lat. (o) | 42.35 | Long. (o) | -70.96 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F043420 | Metagenome / Metatranscriptome | 156 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0116183_12570002 | F043420 | GGA | MKTHTLCQIDGHKKTVLDAINAFCEEMFEDKREVDPVSITGNAFSNNGLAFSLKDGRNNYKVVYRYDMKAFEFFSDGFPEKESEI* |
⦗Top⦘ |