NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0116188_1019627

Scaffold Ga0116188_1019627


Overview

Basic Information
Taxon OID3300009658 Open in IMG/M
Scaffold IDGa0116188_1019627 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR2_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3735
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Cloacimonetes → unclassified Candidatus Cloacimonetes → Candidatus Cloacimonetes bacterium ADurb.Bin003(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameJapan
CoordinatesLat. (o)34.65Long. (o)135.05Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047076Metagenome / Metatranscriptome150N
F077342Metagenome / Metatranscriptome117N

Sequences

Protein IDFamilyRBSSequence
Ga0116188_10196271F047076N/ALIVPELTVKAFVQFYNIAFEKISREVRLLTITFKPTTVSQYENILNLIAAKIDSVKDTSGDDVYWEVRHRKLLIYDSNKELITNATIGNHKLEIEYWARISGAMKPFPTDTGIESDPNAIEYAIEEWNEAGCGIDDTEVQLCALYLMITELAGIFPLEPGTVELYANKFSGAFQAVKTKYNSGNSPATITQVHF*
Ga0116188_10196274F077342GGAGMARTLNEFIVSTGNYVYEITDAEMAGVDLTDFNVAVLLHCVLSDESEKDFIVFSKGRIDQVFDISSKSVPDFMRYSLLYSPTYCRNAGNGIFIVSLPFWRMQRIAESENSDIVSAEFEVVIYGFNTLEYPKGEDEGTASFQCIVIDTGTINFTKNRFPLPLTSVVDEPVQGQLHQLHPREII*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.