Scaffold Ga0123329_1020947

Overview

Basic Information

• Taxon OID: 3300009656
• Scaffold ID: Ga0123329_1020947
• Source Dataset Name: Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C12 SIP DNA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3561
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (71.43%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor → Anaerobic Biogas Reactor Microbial Communites From Washington, Usa

Source Dataset Sampling Location

• Location Name: Washington, USA
• Coordinates
  • Lat. (^o): 47.6525
  • Long. (^o): -122.3049

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042860	Metagenome / Metatranscriptome	157	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0123329_10209472	F042860	GGGGG	MLTREEILKRIEIEDVRIASADRNIEGLILQKNKSLDEQARLFALLEALPPEPEQPEQPLE*