| Basic Information | |
|---|---|
| Taxon OID | 3300009652 Open in IMG/M |
| Scaffold ID | Ga0123330_1065640 Open in IMG/M |
| Source Dataset Name | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_A C13 SIP DNA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1506 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor → Anaerobic Biogas Reactor Microbial Communites From Washington, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Washington, USA | |||||||
| Coordinates | Lat. (o) | 47.6525 | Long. (o) | -122.3049 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F029455 | Metagenome / Metatranscriptome | 188 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0123330_10656404 | F029455 | GGAG | MPDRTIDLDLWDEGAAENLPAITVTGQGLRIEGSIAEFDRLILILGEWLKS* |
| ⦗Top⦘ |