Scaffold Ga0116175_1124092

Overview

Basic Information

• Taxon OID: 3300009648
• Scaffold ID: Ga0116175_1124092
• Source Dataset Name: Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC125_MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 890
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dojkabacteria → Candidatus Dojkabacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: USA
• Coordinates
  • Lat. (^o): 37.78
  • Long. (^o): -122.42

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073597	Metagenome / Metatranscriptome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116175_11240922	F073597	AGG	LPFSRRQALTERGAMETGCFVLQGNQFVSGGNRFVLKRRKKPTPNKPELFLIQLQPFKYISSLFPAGEEGLYTFDYERQLYILKKEEAQIVITEEE*