Basic Information | |
---|---|
Taxon OID | 3300009648 Open in IMG/M |
Scaffold ID | Ga0116175_1003651 Open in IMG/M |
Source Dataset Name | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC125_MetaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 8565 |
Total Scaffold Genes | 13 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 8 (61.54%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA | |||||||
Coordinates | Lat. (o) | 37.78 | Long. (o) | -122.42 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F057301 | Metagenome / Metatranscriptome | 136 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0116175_100365112 | F057301 | N/A | MPNLFGAPKDNDDEFSVDLSEAPTGGGYLIPDGDYPAVLVDLRKGFSKSGNPQWVWTFAIMSGEHAGKEFSLFTALTPSALWKVAETVEALGLGKGGTVSKFTKNEALSRRCIISIQKETYNGQERSSIAKVLPHPDGPGPVTGFNPKKASDGPVPF* |
⦗Top⦘ |