Scaffold Ga0123326_1089292

Overview

Basic Information

• Taxon OID: 3300009647
• Scaffold ID: Ga0123326_1089292
• Source Dataset Name: Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C13 SIP DNA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1048
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae → unclassified Coriobacteriaceae → Coriobacteriaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor → Anaerobic Biogas Reactor Microbial Communites From Washington, Usa

Source Dataset Sampling Location

• Location Name: Washington, USA
• Coordinates
  • Lat. (^o): 47.6525
  • Long. (^o): -122.3049

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068574	Metagenome	124	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0123326_10892922	F068574	GGA	MTIRAMSYAESRLDHFKAVREKRKKTLHWWKYQKPYKQYDQQTIWEMCADLGNEISYLDDVIQMLEKAEVEG*