Basic Information | |
---|---|
Taxon OID | 3300009647 Open in IMG/M |
Scaffold ID | Ga0123326_1071936 Open in IMG/M |
Source Dataset Name | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C13 SIP DNA |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1213 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor → Anaerobic Biogas Reactor Microbial Communites From Washington, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Washington, USA | |||||||
Coordinates | Lat. (o) | 47.6525 | Long. (o) | -122.3049 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F099351 | Metagenome / Metatranscriptome | 103 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0123326_10719361 | F099351 | GGAGG | MNSQYPSPVKVLVELLFVDSVILICIGAAFGKLDEFVGHPMLAFVLFCGAVFLWYRFQET |
⦗Top⦘ |