| Basic Information | |
|---|---|
| Taxon OID | 3300009622 Open in IMG/M |
| Scaffold ID | Ga0105173_1104381 Open in IMG/M |
| Source Dataset Name | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 523 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Southern Atlantic ocean | |||||||
| Coordinates | Lat. (o) | -24.9939 | Long. (o) | -35.9974 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001135 | Metagenome / Metatranscriptome | 767 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0105173_11043811 | F001135 | AGGAG | MIEYKNKKIKLPFVVKSHSTAMVTRTNRLSGESIDLPGFAACVYDYTMYMVELTEEKDRLTNQTPGFSDNQDDWQIVRNGLDWFRQHFAKEYMV |
| ⦗Top⦘ |