Scaffold Ga0105173_1044093

Overview

Basic Information

• Taxon OID: 3300009622
• Scaffold ID: Ga0105173_1044093
• Source Dataset Name: Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 739
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location

• Location Name: Southern Atlantic ocean
• Coordinates
  • Lat. (^o): -24.9939
  • Long. (^o): -35.9974

Associated Families

Family	Category	Number of Sequences	3D Structure?
F106167	Metagenome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105173_10440932	F106167	GGAGG	VEIGDIVKLHINPSVDWMHKYLEETFEVVDFPTETGVRVKMVGTDPEWFWHVGCNEFKIVEEKENGH*