Basic Information | |
---|---|
Taxon OID | 3300009619 Open in IMG/M |
Scaffold ID | Ga0105236_1027359 Open in IMG/M |
Source Dataset Name | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3827_250 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 689 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Southern Atlantic ocean | |||||||
Coordinates | Lat. (o) | 9.7046 | Long. (o) | -55.3027 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F074966 | Metagenome / Metatranscriptome | 119 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0105236_10273592 | F074966 | N/A | AFSDQYNPSPSGQPRINPAGVINKWTSVGVAGKLYSIIGKQMKLPETAAIGRISNKVIYGGAVGGFFDPPSNPRGYVSTASASPNVMVQNRATTMRRNAQFQRNLSYDPSTVSAFV* |
⦗Top⦘ |