NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105228_119693

Scaffold Ga0105228_119693


Overview

Basic Information
Taxon OID3300009613 Open in IMG/M
Scaffold IDGa0105228_119693 Open in IMG/M
Source Dataset NameMarine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3737_250
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)636
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → environmental samples → uncultured marine virus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location
Location NameSouthern Atlantic ocean
CoordinatesLat. (o)6.4994Long. (o)-48.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002078Metagenome / Metatranscriptome596Y
F022754Metagenome / Metatranscriptome213Y

Sequences

Protein IDFamilyRBSSequence
Ga0105228_1196931F022754N/AEVVCSMNELIVAIMLVIPSPYKMVDWTVNEVPTQIQVIHKSGLEVSYTATPVSCNFKPRHKREMIFRSPMDRCYSVFDLSSPRFVRHPDYWYKIELPKPPLVNLGE*
Ga0105228_1196932F002078AGGAGMDIATMFEGQGWFAIAGQIVLIFTAVTGALPDRFVQKIPVLGTLWPIFNWLAGNVFNNINHPKGMAAQSEVEEEIDKAKAKVRTRSGMPDVLDGM*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.