Scaffold Ga0115100_10669557

Overview

Basic Information

• Taxon OID: 3300009608
• Scaffold ID: Ga0115100_10669557
• Source Dataset Name: Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 833
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Eukaryotic Communities From Various Locations To Study Complex Ecological Interactions

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 36.7507
  • Long. (^o): -122.0138
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007565	Metagenome / Metatranscriptome	348	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115100_106695571	F007565	N/A	ITYQGASNGLASVTLSIFNVDHPDDRAWSKHVFDFVAPNGHLSRDKVPEFLTFFYRNRPSGPTLSGAVLDSYPESEAEFIYSLFGSEPTITFATLVDALQEAQANFAEPSAPLEYGSALVLRSDKTKHTRCVLDPQQRFRQPMTTSQEVGWELLSEPQGMPQAPPAGNPFHLRTSATTQFADAMEKQTWGRSIGGEFSAYAMRKLVEFGGQGMGV*