Scaffold Ga0115102_10855869

Overview

Basic Information

• Taxon OID: 3300009606
• Scaffold ID: Ga0115102_10855869
• Source Dataset Name: Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 629
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Isochrysidaceae → Chrysotila → Chrysotila carterae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Eukaryotic Communities From Various Locations To Study Complex Ecological Interactions

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 36.6953
  • Long. (^o): -122.3565
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071920	Metagenome / Metatranscriptome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115102_108558691	F071920	N/A	MAVAHLVMLVLPGLVATTVPKFNNSKCPSFSEMQAPHVATDFRAERDIPGYYYELAFHDVTQRPLCPGKPRCITSEKAIQTHSDGVKFVNDTWNLQCFGAAYPQTLLFNVTENNGYLRGYVPTTKIPFLPPSVVAGTVFPDTVVDFKAGPEGWLLEVQCVEALGHVLFVGINFYSKLKTEAAFQEMYAAGK