Scaffold Ga0114906_1119294

Overview

Basic Information

• Taxon OID: 3300009605
• Scaffold ID: Ga0114906_1119294
• Source Dataset Name: Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 933
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis → Rhodococcus erythropolis SK121 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: Mediterranean Sea
• Coordinates
  • Lat. (^o): 38.38
  • Long. (^o): 4.65
  • Depth (m): 2720

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045148	Metagenome	153	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114906_11192942	F045148	GGAGG	MTAPTDWVELTASCGRCDRQDTVSVPEAKYTEWKAGANIAWVFKNLSLQQRDVLIGSDTARPFPYYLCGSCWDLTFKGMEDER*