Scaffold Ga0114911_1125298

Overview

Basic Information

• Taxon OID: 3300009603
• Scaffold ID: Ga0114911_1125298
• Source Dataset Name: Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 733
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: Mediterranean Sea
• Coordinates
  • Lat. (^o): 43.49
  • Long. (^o): 7.9
  • Depth (m): 2455

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001651	Metagenome / Metatranscriptome	657	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114911_11252982	F001651	N/A	SRAQVWNDVKRRLAEVRRDDKEAVQQEYNLQRSRYERLLLRWWSQATGPDDSQAARATGIVLDILRRLDTIGGLIPEKPLIQLQQQNVMVGGVTFADLLREAMDGAGQVVEGERVDLGTDLAVEN*