Scaffold Ga0114911_1012080

Overview

Basic Information

• Taxon OID: 3300009603
• Scaffold ID: Ga0114911_1012080
• Source Dataset Name: Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3070
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: Mediterranean Sea
• Coordinates
  • Lat. (^o): 43.49
  • Long. (^o): 7.9
  • Depth (m): 2455

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064624	Metagenome	128	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114911_10120805	F064624	GGAG	MTQQQPPVPTPVQLTVDDMTALIQTDETSRLKVQGIALQRRVAELEAENAELKAQIAEPDTTTTNNKNDSKLTAVGAD*