Scaffold Ga0115011_10406246

Overview

Basic Information

• Taxon OID: 3300009593
• Scaffold ID: Ga0115011_10406246
• Source Dataset Name: Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1061
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Tropical Atlantic Ocean
• Coordinates
  • Lat. (^o): 15.249
  • Long. (^o): -20.515
  • Depth (m): 55

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099841	Metagenome / Metatranscriptome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115011_104062465	F099841	AGGA	MKDLNGVSEDFGHRWTDSYDGDNVECQYCGDSYGSKRWCTNRLVVSEQDREMDESMSLYYSQEADK*