Scaffold Ga0105159_1025974

Overview

Basic Information

• Taxon OID: 3300009590
• Scaffold ID: Ga0105159_1025974
• Source Dataset Name: Hot spring microbial communities from Little Hot Creek, USA to study Microbial Dark Matter (Phase II) - LHC4sed_replicate
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1182
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: USA: California, Little Hot Creek
• Coordinates
  • Lat. (^o): 37.6906
  • Long. (^o): -118.8442

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064214	Metagenome	129	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105159_10259744	F064214	AGGTGG	MKSDLKVLVKSAEDLACALRDTLDVLADHERRIKLIEEKLGFAPDLETRASKRAVKEARMV*