Scaffold Ga0115596_1186448

Overview

Basic Information

• Taxon OID: 3300009580
• Scaffold ID: Ga0115596_1186448
• Source Dataset Name: Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_C (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 615
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland → Wetland Microbial Communities From Old Woman Creek Reserve In Ohio, Usa

Source Dataset Sampling Location

• Location Name: Old Woman Creek National Estuarine Research Reserve, Ohio, USA
• Coordinates
  • Lat. (^o): 41.2239
  • Long. (^o): -82.3039

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020700	Metagenome / Metatranscriptome	222	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115596_11864481	F020700	GAG	MTTRLSLHLRFARLCPKTLRGVFSDAAAGIAATSIGLNFPFLFQVVKPEKVRRIL