| Basic Information | |
|---|---|
| Taxon OID | 3300009580 Open in IMG/M |
| Scaffold ID | Ga0115596_1076553 Open in IMG/M |
| Source Dataset Name | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_C (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 530 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland → Wetland Microbial Communities From Old Woman Creek Reserve In Ohio, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Old Woman Creek National Estuarine Research Reserve, Ohio, USA | |||||||
| Coordinates | Lat. (o) | 41.2239 | Long. (o) | -82.3039 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F042356 | Metagenome / Metatranscriptome | 158 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0115596_10765531 | F042356 | N/A | VHQHGAGDSGGFNKKETAQRKPSKGGQKERAHREGHDGSAGRVKNFRVPAMLKTTPLACEQKAT* |
| ⦗Top⦘ |