Basic Information | |
---|---|
Taxon OID | 3300009566 Open in IMG/M |
Scaffold ID | Ga0130025_1182299 Open in IMG/M |
Source Dataset Name | Methanogenic o-xylene degrading microbial communities from aquifer solids in Pensacola, Florida - enrichment culture X8-AB |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Colorado |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 612 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Deep Subsurface → Aquifer → Unclassified → Aquifer Solids → Methanogenic O-Xylene Degrading Microbial Communities From Aquifer Solids In Pensacola, Florida - Enrichment Culture X8-Ab |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Pensacola, Florida | |||||||
Coordinates | Lat. (o) | 30.703611 | Long. (o) | -87.369167 | Alt. (m) | Depth (m) | 6 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F089758 | Metagenome | 108 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0130025_11822992 | F089758 | N/A | GKPFESEACLRRARELCRRGNLQKNSDDKVYGTPPGLVSVVDLSHEMHRACSRLAKVLEDAGWFQVLELPGYYFPPESKEGLE* |
⦗Top⦘ |