Scaffold Ga0130025_1102987

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0130025_1102987

Scaffold Ga0130025_1102987

Overview

Basic Information
Taxon OID	3300009566 Open in IMG/M
Scaffold ID	Ga0130025_1102987 Open in IMG/M
Source Dataset Name	Methanogenic o-xylene degrading microbial communities from aquifer solids in Pensacola, Florida - enrichment culture X8-AB
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Colorado
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	871
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Aquifer → Unclassified → Aquifer Solids → Methanogenic O-Xylene Degrading Microbial Communities From Aquifer Solids In Pensacola, Florida - Enrichment Culture X8-Ab

Source Dataset Sampling Location
Location Name	Pensacola, Florida
Coordinates	Lat. (^o)	30.703611	Long. (^o)	-87.369167	Alt. (m)		Depth (m)	6
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060932	Metagenome / Metatranscriptome	132	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0130025_11029872	F060932	AGG	MKTKYLVIVAASLVLLAGGAFVLTRSQDVAAQSPTPESYPATVTVKNFAPAGEKIQLGISSAQASQDKLTLTLTMSGVDYEEKISNYSFTGFEKLVCNPYIVTKERVPVMFQGYEVKSGDPTQVIYTYSLKGNTYTELNLTMDWTIGPCAPAFDESNVKAPRDPLLTNYHFEFVVPVK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.