NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0130030_1031499

Scaffold Ga0130030_1031499


Overview

Basic Information
Taxon OID3300009563 Open in IMG/M
Scaffold IDGa0130030_1031499 Open in IMG/M
Source Dataset NameAquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 5, Depth 6m; RNA IDBA-UD
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterMarine Biological Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)815
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond → Aquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts

Source Dataset Sampling Location
Location NameFalmouth, Massachusetts
CoordinatesLat. (o)41.548517Long. (o)-70.622961Alt. (m)Depth (m)6
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024770Metagenome / Metatranscriptome204Y
F053995Metagenome / Metatranscriptome140N

Sequences

Protein IDFamilyRBSSequence
Ga0130030_10314991F024770AGGAGMAISHQRVSIGTTATQISSDFAGKDGQTVSVQNPTGGATVYLGGEGVTTSAYGFALGEGTTFSIEMQDGEKLYGVV
Ga0130030_10314993F053995N/ASVGAIQGSTGDMVYGLDFGTASVDPASIEATSRGSVTFTLTGAKTTDIIIVNPPAGLNDDLIFCGAAISAADTVSIYLYNPTAEAINDTARTFSYVWIDMTA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.