Scaffold Ga0115013_10315149

Overview

Basic Information

• Taxon OID: 3300009550
• Scaffold ID: Ga0115013_10315149
• Source Dataset Name: Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 973
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location

• Location Name: South Atlantic Ocean
• Coordinates
  • Lat. (^o): -17.283
  • Long. (^o): 2.9768
  • Depth (m): 30

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033640	Metagenome / Metatranscriptome	177	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115013_103151496	F033640	AGG	VITLYFRSLDDLDGWTEEFETVEEAASHFLYQMGKTHDIGSSYAVNTYGDVTCTVEGA