NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0115013_10257997

Scaffold Ga0115013_10257997


Overview

Basic Information
Taxon OID3300009550 Open in IMG/M
Scaffold IDGa0115013_10257997 Open in IMG/M
Source Dataset NameMarine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1065
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location NameSouth Atlantic Ocean
CoordinatesLat. (o)-17.283Long. (o)2.9768Alt. (m)Depth (m)30
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F063755Metagenome / Metatranscriptome129Y
F065936Metagenome / Metatranscriptome127Y

Sequences

Protein IDFamilyRBSSequence
Ga0115013_102579972F065936AGGAGMGTFTMETGFGLLIAGFVVLAVAGTIIFITINTIEDNKMKKEQERKQREKVDGLN*
Ga0115013_102579974F063755GGAMIIYGHSGQDIRRAIWRRRYKFLSVFAVIVIAVMLTGCGTAENKKIELKALDQFWDALGGKTKDLVKETK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.