Basic Information | |
---|---|
Taxon OID | 3300009544 Open in IMG/M |
Scaffold ID | Ga0115006_10871448 Open in IMG/M |
Source Dataset Name | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 795 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Arctic Ocean | |||||||
Coordinates | Lat. (o) | 78.8697 | Long. (o) | 8.1122 | Alt. (m) | Depth (m) | 10 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F013062 | Metagenome / Metatranscriptome | 274 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0115006_108714481 | F013062 | GGCGG | MTYSRSPQRHLNHFGLPTRFTEWARLAQDRAGWHELVTTPPFAIGEPFVRQPRGDARVTPEDRRRAVAQRAAEIAERRAVFDANKNN* |
⦗Top⦘ |