Scaffold Ga0115006_10538569

Overview

Basic Information

• Taxon OID: 3300009544
• Scaffold ID: Ga0115006_10538569
• Source Dataset Name: Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1023
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Arctic Ocean
• Coordinates
  • Lat. (^o): 78.8697
  • Long. (^o): 8.1122
  • Depth (m): 10

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031250	Metagenome	183	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115006_105385692	F031250	AGGAG	MEGLYNKENLFAEFAMKKTNADKVKFLQEMKELKKSQPHMFRGTSITQKNFDNLIEEWSKPQPWVEVNRAIKERNRIINSVEGEDVKLNV*