Scaffold Ga0129283_10002057

Overview

Basic Information

• Taxon OID: 3300009537
• Scaffold ID: Ga0129283_10002057
• Source Dataset Name: Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - D-2W
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Delaware
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 10393
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (12.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater → Microbial Role In Biogeochemical Cycling In A Beach Aquifer System

Source Dataset Sampling Location

• Location Name: Cape Shores, Lewes, Delaware, USA
• Coordinates
  • Lat. (^o): 38.7855
  • Long. (^o): -75.1045

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002045	Metagenome / Metatranscriptome	599	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0129283_100020574	F002045	N/A	VAQEPKKINFFVVYCKTRKKFDKFIKVNKIRNKYIIDIKKIAEEEEIENGDKMYLKILIFNKIQQAMDKKKDIYFIPDFDDDFSIEKLLNLRKILEHNNFNVLVFYNEFKDKSKLLDDVFENLSKFSNSQIIRDY*