Scaffold Ga0129283_10000180

Overview

Basic Information

• Taxon OID: 3300009537
• Scaffold ID: Ga0129283_10000180
• Source Dataset Name: Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - D-2W
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Delaware
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 39125
• Total Scaffold Genes: 29
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 19 (65.52%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater → Microbial Role In Biogeochemical Cycling In A Beach Aquifer System

Source Dataset Sampling Location

• Location Name: Cape Shores, Lewes, Delaware, USA
• Coordinates
  • Lat. (^o): 38.7855
  • Long. (^o): -75.1045

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034662	Metagenome / Metatranscriptome	174	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0129283_1000018015	F034662	GAG	MPTVDIAALGATRKLLGFSRRSVEVERGTVADLLQSLQTVEGDNLYAHLVGDGKLRGDYAIVVDGLSLRADQLDKPLKGGEQVVTMAILYHLHGG*