Scaffold Ga0129295_11744157

Overview

Basic Information

• Taxon OID: 3300009536
• Scaffold ID: Ga0129295_11744157
• Source Dataset Name: Marine microbial communities associated with Trichodesmium colonies (puff morphology) from Station ALOHA, North Pacific Subtropical Gyre ? E19
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Oregon State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 529
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Pelagic → Unclassified → Marine → Marine Microbial Communities Associated With Trichodesmium Colonies (Puff Morphology) From Station Aloha, North Pacific Subtropical Gyre

Source Dataset Sampling Location

• Location Name: North Pacific Subtropical Gyre
• Coordinates
  • Lat. (^o): 22.0
  • Long. (^o): -158.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002883	Metagenome / Metatranscriptome	523	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0129295_117441571	F002883	N/A	MSTLHHEDMLLEIFDEVCEAFPYLDEEKQIEIANNKFQELYQ*