| Basic Information | |
|---|---|
| Taxon OID | 3300009536 Open in IMG/M |
| Scaffold ID | Ga0129295_11620139 Open in IMG/M |
| Source Dataset Name | Marine microbial communities associated with Trichodesmium colonies (puff morphology) from Station ALOHA, North Pacific Subtropical Gyre ? E19 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Oregon State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 942 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Pelagic → Unclassified → Marine → Marine Microbial Communities Associated With Trichodesmium Colonies (Puff Morphology) From Station Aloha, North Pacific Subtropical Gyre |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | North Pacific Subtropical Gyre | |||||||
| Coordinates | Lat. (o) | 22.0 | Long. (o) | -158.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021120 | Metagenome / Metatranscriptome | 220 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0129295_116201391 | F021120 | N/A | GIVGSEMCIRDSRGKVLMKVFTIQFTEDELTELENVLDQHVYAEAIENKGSEGTIGTIHNRILDVHYQNSDGLVPVQEVAHKHFRKDLDLL* |
| ⦗Top⦘ |