Scaffold Ga0129295_11498970

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0129295_11498970

Scaffold Ga0129295_11498970

Overview

Basic Information
Taxon OID	3300009536 Open in IMG/M
Scaffold ID	Ga0129295_11498970 Open in IMG/M
Source Dataset Name	Marine microbial communities associated with Trichodesmium colonies (puff morphology) from Station ALOHA, North Pacific Subtropical Gyre ? E19
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Oregon State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	911
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Marine → Marine Microbial Communities Associated With Trichodesmium Colonies (Puff Morphology) From Station Aloha, North Pacific Subtropical Gyre

Source Dataset Sampling Location
Location Name	North Pacific Subtropical Gyre
Coordinates	Lat. (^o)	22.0	Long. (^o)	-158.0	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068936	Metagenome / Metatranscriptome	124	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0129295_114989701	F068936	N/A	MSAASFGISLILVGVIIYLNMTKQQRVDENRKYMLDVIEKMVDARIQQSMPDVTGPVYGTDTKN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.