| Basic Information | |
|---|---|
| Taxon OID | 3300009536 Open in IMG/M |
| Scaffold ID | Ga0129295_10299718 Open in IMG/M |
| Source Dataset Name | Marine microbial communities associated with Trichodesmium colonies (puff morphology) from Station ALOHA, North Pacific Subtropical Gyre ? E19 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Oregon State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 662 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Haifavirus → Haifavirus tim68 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Pelagic → Unclassified → Marine → Marine Microbial Communities Associated With Trichodesmium Colonies (Puff Morphology) From Station Aloha, North Pacific Subtropical Gyre |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | North Pacific Subtropical Gyre | |||||||
| Coordinates | Lat. (o) | 22.0 | Long. (o) | -158.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F018383 | Metagenome / Metatranscriptome | 235 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0129295_102997182 | F018383 | AGGAGG | MEKLTFNNEQLEFLKFIVQDFEYNDDHERYMIEQIENKIYQAQEKLMLRVIGGMS* |
| ⦗Top⦘ |