| Basic Information | |
|---|---|
| Taxon OID | 3300009529 Open in IMG/M |
| Scaffold ID | Ga0114919_10491252 Open in IMG/M |
| Source Dataset Name | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 847 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → environmental samples → uncultured virus | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Atlantic Ocean: Black Sea | |||||||
| Coordinates | Lat. (o) | 44.288 | Long. (o) | 34.983 | Alt. (m) | Depth (m) | 2075 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F022978 | Metagenome / Metatranscriptome | 212 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0114919_104912522 | F022978 | GGA | MLEFAESVLKEVRKLQEDSEAIVLNGSITDMERYRFLMGRLEGIKLVDQIIRDKLDKHSEEF* |
| ⦗Top⦘ |