Basic Information | |
---|---|
Taxon OID | 3300009528 Open in IMG/M |
Scaffold ID | Ga0114920_10878132 Open in IMG/M |
Source Dataset Name | Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 614 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | South Pacific Ocean | |||||||
Coordinates | Lat. (o) | -44.283 | Long. (o) | -75.865 | Alt. (m) | Depth (m) | 3285 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F049998 | Metagenome | 146 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0114920_108781322 | F049998 | N/A | MIKDELEIKAFYKGKEVKIIELHHLSFFHSGLITLARKWKVKPFDVLMEDVSDETTQAALNIMIGLIYKDMCTKSGWEINLKKFKNEMLLKNKKPKVFLMESDYLKIPDNHFDDGIRLLKKIGFIRTGYHHSYIQINNSIMDYCRKLGNYLFDTWYCQESFKR |
⦗Top⦘ |