Basic Information | |
---|---|
Taxon OID | 3300009527 Open in IMG/M |
Scaffold ID | Ga0114942_1318489 Open in IMG/M |
Source Dataset Name | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold Creek |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 601 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lower Cold Creek, Nevada | |||||||
Coordinates | Lat. (o) | 36.42 | Long. (o) | -115.74 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F084530 | Metagenome / Metatranscriptome | 112 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0114942_13184891 | F084530 | N/A | RFALSTALVTPTDATRRRMGKRLRSYVIWAERRAGRRQPPHIPPAEDPFWALLTWLER* |
⦗Top⦘ |